PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0259s0019.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family ARR-B
Protein Properties Length: 768aa    MW: 82786.4 Da    PI: 5.0965
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0259s0019.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.84.9e-28265318155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kpr++W+ +LH++Fv av+qL G +kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Sphfalx0259s0019.1.p 265 KPRVVWSVDLHQQFVCAVNQL-GVDKAVPKRILELMGVQGLTRENVASHLQKYRL 318
                           79*******************.********************************8 PP

2Response_reg74.63.8e-25851931109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+vdD+++ + +l+++l++  y +v+++ ++++alell++ +  +D+++ D+ mp+mdG++ll+     e++lp+i+++a+g+ + + 
  Sphfalx0259s0019.1.p  85 VLVVDDDRTCLVILEKMLRRCAY-QVTTCWKATKALELLRAYKdaFDVVISDVIMPDMDGFKLLELVGL-EMDLPVIMMSANGAVSAVM 171
                           89*********************.***************999999*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+ +eel++
  Sphfalx0259s0019.1.p 172 KGITHGACDYLLKPVRIEELRN 193
                           ********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.18E-3582207IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.6E-4282218No hitNo description
SMARTSM004481.2E-3083195IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.80584199IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.1E-2285194IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.25E-2586198No hitNo description
SuperFamilySSF466895.38E-19262322IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-29264323IPR009057Homeodomain-like
PROSITE profilePS5129410.164264321IPR017930Myb domain
TIGRFAMsTIGR015574.5E-24265318IPR006447Myb domain, plants
PfamPF002491.4E-8267317IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MGPPPPPGEQ RSTTATVELH QQHQQQEIKQ KHCGREEQQE GRQQQKQPSD ADSNGKTTTT  60
SDTSNDDSYT KMDPPGNDFP AGMRVLVVDD DRTCLVILEK MLRRCAYQVT TCWKATKALE  120
LLRAYKDAFD VVISDVIMPD MDGFKLLELV GLEMDLPVIM MSANGAVSAV MKGITHGACD  180
YLLKPVRIEE LRNIWQHVVR KKRNVSKEVE RSASADGGEH QNGEYASSGN DSTDANWKLS  240
RKRREAKEPD DDTDLDGDDP SCLKKPRVVW SVDLHQQFVC AVNQLGVDKA VPKRILELMG  300
VQGLTRENVA SHLQKYRLYL RRLTNQQGGD ATFGPGAFDF SSCDGDFQLL AGGSGQMPPV  360
QTLAALRADL LSGSGANDFG GDLDTATILQ FADLQGSANV GNVGPTMRPQ MSSPSPVGDR  420
TLLFQGVTDL DQLSQPHRVS AIRQQPGSID EATALTASIQ QHIVETSGLQ SLNTNLPGRA  480
QPENALIMQL LQQRAGADNT GRAGGFLPLV GTELDTRALS DVLGTGRRLI GPPPGSMVAT  540
VSSALDALIR PNSNANYLGQ STGIVPSTFP PAGMGTGPHV INESPNEATV EVSFLQSQNT  600
GNGCGQIVNQ NNIRSGWSAL QTGLSSFHDE LGLPQVARFS SHYDYNHIVT ANNLGSEGVV  660
SGQGGSELVF PSRLAADRAV IGPVHNGSGH CNYRGSETAD SNDKWMRDER RAGSVYSKLE  720
RPFSSTDASS DDLFNMVFNK QPQVGSMNLL EGDLGSDGYV LDGLFVK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-20264324464ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S16_393V6.11e-118(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-103response regulator 2